Kortikotropin-oslobađajući hormon

(Preusmjereno sa stranice Kortikoliberin)
edit

Kortikotropin-oslobađajući hormon (CRH, originalno nazvan kortikotropin-oslobađajući faktor, CRF, takođe poznat kao kortikoliberin), je polipeptidni hormon i neurotransmiter koji učestvuje u odgovoru organizma na stres. On pripada familiji kortikotropin-oslobađajućih faktora.

Kortikotropin-oslobađajući hormon

PDB prikaz baziran na 1go9.
Dostupne strukture
1go9, 1goe
Identifikatori
SimboliCRH; CRF
Vanjski IDOMIM122560 MGI88496 HomoloGene599 GeneCards: CRH Gene
Pregled RNK izražavanja
PBB GE CRH 205630 at tn.png
PBB GE CRH 205629 s at tn.png
podaci
Ortolozi
VrstaČovekMiš
Entrez139212918
EnsemblENSG00000147571ENSMUSG00000049796
UniProtP06850Q14AA2
RefSeq (mRNA)NM_000756NM_205769
RefSeq (protein)NP_000747NP_991338
Lokacija (UCSC)Chr 8:
67.25 - 67.25 Mb
Chr 3:
19.89 - 19.89 Mb
PubMed pretraga[1][2]

Njegova glavna funkcija je stimulacija hipofizne sinteze adrenokortikotropnog hormona.

Kortikotropin-oslobađajuči hormon je 41-aminokiselina dug peptid izveden iz 191-aminokiselinskog preprohormona. CRH izlučuje paraventrikularni nukleus (PVN) hipotalamusa u odgovoru na stres. Primetno umanjenje CRH koncentracije je bilo primećeno kod obolelih od Alchajmerove bolesti. Osim što se proizvodi u hipotalamusu, CRH je takođe sintetisan u perifernim tkivima, poput T limfocita, i visoko je izražen u posteljici. U posteljici je CRH služi kao indikator koji određuje dužinu gestacije i vreme porođaja. Brzo povišenje CRH nivoa u cirkulaciji se javlja na početku porođaja.[1]

StrukturaUredi

CRH su otkrili Vale et al. kod ovaca 1981.[2] Njegova sekvenca je:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

Peptidi pacova i čoveka su identični i razlikuju se od ovčije sekvence za samo 7 aminokiselina.[3]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

InterakcijeUredi

Za kortikotropin-oslobađajući hormon je pokazano da interaguje sa kortikotropin-oslobađajućim hormonskim receptorom 1.[4][5]

Vidi jošUredi

ReferenceUredi

  1. „Entrez Gene: CRH corticotropin releasing hormone”. 
  2. Vale W, Spiess J, Rivier C, Rivier J (September 1981). „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science (journal) 213 (4514): 1394–7. DOI:10.1126/science.6267699. PMID 6267699. 
  3. Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (March 1985). „NIH conference. Clinical applications of corticotropin-releasing factor.”. Annals of internal medicine 102 (3): 344–358. PMID 2982307. 
  4. Grammatopoulos, D K; Dai Y, Randeva H S, Levine M A, Karteris E, Easton A J, Hillhouse E W (December 1999). „A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes”. Mol. Endocrinol. (UNITED STATES) 13 (12): 2189–202. DOI:10.1210/me.13.12.2189. ISSN 0888-8809. PMID 10598591. 
  5. Gottowik, J; Goetschy V, Henriot S, Kitas E, Fluhman B, Clerc R G, Moreau J L, Monsma F J, Kilpatrick G J (October 1997). „Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H-urocortin”]. Neuropharmacology (ENGLAND) 36 (10): 1439–46. DOI:10.1016/S0028-3908(97)00098-1. ISSN 0028-3908. PMID 9423932. 

LiteraturaUredi

Spoljašnje vezeUredi


Šablon:Neuropeptidni ligandi

  Molimo Vas, obratite pažnju na važno upozorenje u vezi tema o zdravlju (medicini).