Kortikotropin-oslobađajući hormon
edit |
Kortikotropin-oslobađajući hormon (CRH, originalno nazvan kortikotropin-oslobađajući faktor, CRF, takođe poznat kao kortikoliberin), je polipeptidni hormon i neurotransmiter koji učestvuje u odgovoru organizma na stres. On pripada familiji kortikotropin-oslobađajućih faktora.
Kortikotropin-oslobađajući hormon | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
PDB prikaz baziran na 1go9. | |||||||||||
Dostupne strukture | |||||||||||
1go9, 1goe | |||||||||||
Identifikatori | |||||||||||
Simboli | CRH; CRF | ||||||||||
Vanjski ID | OMIM: 122560 MGI: 88496 HomoloGene: 599 GeneCards: CRH Gene | ||||||||||
| |||||||||||
Pregled RNK izražavanja | |||||||||||
podaci | |||||||||||
Ortolozi | |||||||||||
Vrsta | Čovek | Miš | |||||||||
Entrez | 1392 | 12918 | |||||||||
Ensembl | ENSG00000147571 | ENSMUSG00000049796 | |||||||||
UniProt | P06850 | Q14AA2 | |||||||||
RefSeq (mRNA) | NM_000756 | NM_205769 | |||||||||
RefSeq (protein) | NP_000747 | NP_991338 | |||||||||
Lokacija (UCSC) | Chr 8: 67.25 - 67.25 Mb | Chr 3: 19.89 - 19.89 Mb | |||||||||
PubMed pretraga | [1] | [2] |
Njegova glavna funkcija je stimulacija hipofizne sinteze adrenokortikotropnog hormona.
Kortikotropin-oslobađajuči hormon je 41-aminokiselina dug peptid izveden iz 191-aminokiselinskog preprohormona. CRH izlučuje paraventrikularni nukleus (PVN) hipotalamusa u odgovoru na stres. Primetno umanjenje CRH koncentracije je bilo primećeno kod obolelih od Alchajmerove bolesti. Osim što se proizvodi u hipotalamusu, CRH je takođe sintetisan u perifernim tkivima, poput T limfocita, i visoko je izražen u posteljici. U posteljici je CRH služi kao indikator koji određuje dužinu gestacije i vreme porođaja. Brzo povišenje CRH nivoa u cirkulaciji se javlja na početku porođaja.[1]
Struktura uredi
CRH su otkrili Vale et al. kod ovaca 1981.[2] Njegova sekvenca je:
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA
Peptidi pacova i čoveka su identični i razlikuju se od ovčije sekvence za samo 7 aminokiselina.[3]
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Interakcije uredi
Za kortikotropin-oslobađajući hormon je pokazano da interaguje sa kortikotropin-oslobađajućim hormonskim receptorom 1.[4][5]
Vidi još uredi
Reference uredi
- ↑ „Entrez Gene: CRH corticotropin releasing hormone”.
- ↑ Vale W, Spiess J, Rivier C, Rivier J (September 1981). „Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin”. Science (journal) 213 (4514): 1394–7. DOI:10.1126/science.6267699. PMID 6267699.
- ↑ Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (March 1985). „NIH conference. Clinical applications of corticotropin-releasing factor.”. Annals of internal medicine 102 (3): 344–358. PMID 2982307.
- ↑ Grammatopoulos, D K; Dai Y, Randeva H S, Levine M A, Karteris E, Easton A J, Hillhouse E W (December 1999). „A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes”. Mol. Endocrinol. (UNITED STATES) 13 (12): 2189–202. DOI:10.1210/me.13.12.2189. ISSN 0888-8809. PMID 10598591.
- ↑ Gottowik, J; Goetschy V, Henriot S, Kitas E, Fluhman B, Clerc R G, Moreau J L, Monsma F J, Kilpatrick G J (October 1997). „Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H-urocortin”]. Neuropharmacology (ENGLAND) 36 (10): 1439–46. DOI:10.1016/S0028-3908(97)00098-1. ISSN 0028-3908. PMID 9423932.
Literatura uredi
- Florio P, Severi FM, Ciarmela P, et al. (2003). „Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family”. Endocrine 19 (1): 91–102. DOI:10.1385/ENDO:19:1:91. PMID 12583606.
- Florio P, Rossi M, Sigurdardottir M, et al. (2003). „Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A”. Steroids 68 (10–13): 801–7. DOI:10.1016/S0039-128X(03)00137-5. PMID 14667971.
- Vamvakopoulos NC, Karl M, Mayol V, et al. (1990). „Structural analysis of the regulatory region of the human corticotropin releasing hormone gene”. FEBS Lett. 267 (1): 1–5. DOI:10.1016/0014-5793(90)80272-K. PMID 2365075.
- Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA (1989). „Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing”. Mol. Cell. Endocrinol. 61 (2): 175–80. DOI:10.1016/0303-7207(89)90128-7. PMID 2783917.
- Arbiser JL, Morton CC, Bruns GA, Majzoub JA (1988). „Human corticotropin releasing hormone gene is located on the long arm of chromosome 8”. Cytogenet. Cell Genet. 47 (3): 113–6. DOI:10.1159/000132525. PMID 3259914.
- Sasaki A, Tempst P, Liotta AS, et al. (1988). „Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta”. J. Clin. Endocrinol. Metab. 67 (4): 768–73. DOI:10.1210/jcem-67-4-768. PMID 3262120.
- Shibahara S, Morimoto Y, Furutani Y, et al. (1984). „Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene”. EMBO J. 2 (5): 775–9. PMC 555184. PMID 6605851.
- Behan DP, Heinrichs SC, Troncoso JC, et al. (1995). „Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease”. Nature 378 (6554): 284–7. DOI:10.1038/378284a0. PMID 7477348.
- Kawahito Y, Sano H, Mukai S, et al. (1996). „Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis”. Gut 37 (4): 544–51. DOI:10.1136/gut.37.4.544. PMC 1382908. PMID 7489943.
- McLean M, Bisits A, Davies J, et al. (1995). „A placental clock controlling the length of human pregnancy”. Nat. Med. 1 (5): 460–3. DOI:10.1038/nm0595-460. PMID 7585095.
- Slominski A, Ermak G, Hwang J, et al. (1995). „Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin”. FEBS Lett. 374 (1): 113–6. DOI:10.1016/0014-5793(95)01090-2. PMID 7589495.
- Sutton SW, Behan DP, Lahrichi SL, et al. (1995). „Ligand requirements of the human corticotropin-releasing factor-binding protein”. Endocrinology 136 (3): 1097–102. DOI:10.1210/en.136.3.1097. PMID 7867564.
- Vamvakopoulos NC, Chrousos GP (1994). „Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene”. DNA Seq. 4 (3): 197–206. DOI:10.3109/10425179309015632. PMID 8161822.
- Perrin MH, Donaldson CJ, Chen R, et al. (1994). „Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor”. Endocrinology 133 (6): 3058–61. DOI:10.1210/en.133.6.3058. PMID 8243338.
- Romier C, Bernassau JM, Cambillau C, Darbon H (1993). „Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics”. Protein Eng. 6 (2): 149–56. DOI:10.1093/protein/6.2.149. PMID 8386360.
- Liaw CW, Grigoriadis DE, Lovenberg TW, et al. (1997). „Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach”. Mol. Endocrinol. 11 (7): 980–5. DOI:10.1210/me.11.7.980. PMID 9178757.
- Timpl P, Spanagel R, Sillaber I, et al. (1998). „Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1”. Nat. Genet. 19 (2): 162–6. DOI:10.1038/520. PMID 9620773.
- Perone MJ, Murray CA, Brown OA, et al. (1998). „Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells”. Mol. Cell. Endocrinol. 142 (1–2): 191–202. DOI:10.1016/S0303-7207(98)00104-X. PMID 9783915.
- Willenberg HS, Bornstein SR, Hiroi N, et al. (2000). „Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function”. Mol. Psychiatry 5 (2): 137–41. DOI:10.1038/sj.mp.4000720. PMID 10822340.
- Saeed B, Fawcett M, Self C (2001). „Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes”. Eur. J. Clin. Invest. 31 (2): 125–30. DOI:10.1046/j.1365-2362.2001.00770.x. PMID 11168450.